Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-Proapoptotic Caspase Adaptor Protein, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP192287

Catalog No. NBP192287


Add to cart

Description

Description

Proapoptotic Caspase Adaptor Protein Polyclonal antibody specifically detects Proapoptotic Caspase Adaptor Protein in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

Proapoptotic Caspase Adaptor Protein
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
caspase-2 binding protein, FLJ32987, HSPC190, marginal zone B and B1 cell-specific protein, MGC29506, PACAP, pERp1, plasma cell-induced ER protein 1, plasma cell-induced resident endoplasmic reticulum protein, Plasma cell-induced resident ER protein, Proapoptotic caspase adapter protein, proapoptotic caspase adaptor protein
Rabbit
IgG
0.1 ml
Apoptosis, Caspases
Primary
51237
Human
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Western Blot 0.4 ug/ml, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000
Affinity Purified
MZB1
This antibody was developed against Recombinant Protein corresponding to amino acids:YGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSATR
Immunogen affinity purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only