Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-Proteasome 19S S5A, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP190821

Catalog No. NBP190821


Add to cart

Description

Description

S5a/Angiocidin Polyclonal antibody specifically detects S5a/Angiocidin in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications

Specifications

Proteasome 19S S5A
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Affinity Purified
PSMD4
This antibody was developed against Recombinant Protein corresponding to amino acids:VCHSKTRSNPENNVGLITLANDCEVLTTLTPDTGRILSKLHTVQPKGKITFCTGI
Immunogen affinity purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
P55036
26S proteasome non-ATPase regulatory subunit 4, 26S proteasome regulatory subunit S5A, AF-1,26S protease subunit S5a, AFMCB1, angiocidin, Antisecretory factor 1, ASF, multiubiquitin chain binding protein, Multiubiquitin chain-binding protein, proteasome (prosome, macropain) 26S subunit, non-ATPase, 4, pUB-R5,26S proteasome regulatory subunit RPN10, Rpn10, RPN10 homolog, S5A, S5a/antisecretory factor protein
Rabbit
IgG
0.1 ml
Neuroscience, Ubiquitin Proteasome Pathway
Primary
5710
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only