Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PSARL, Mouse, Clone: 4F4, Abnova™

Mouse monoclonal antibody raised against a partial recombinant PSARL.

Manufacturer:  Abnova Corporation H00055486M02

Catalog No. 89-002-637


Add to cart

Description

Description

This gene encodes a mitochondrial integral membrane protein. Following proteolytic processing of this protein, a small peptide (P-beta) is formed and translocated to the nucleus. This gene may be involved in signal transduction via regulated intramembrane proteolysis of membrane-tethered precursor proteins. Variation in this gene has been associated with increased risk for type 2 diabetes. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq

Sequence: AWRGWAQRGWGCGQAWGASVGGRSCEELTAVLTPPQLLGRRFNFFIQQKCGFRKAPRKVEPRRSDPGTSGEAYKRSALIPPVEETVFYPSPYPIRSLIK
Specifications

Specifications

PSARL
4F4
Mouse monoclonal antibody raised against a partial recombinant PSARL.
PARL
Liquid
PARL
PSARL (NP_061092.3, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
100 ug
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
ELISA
Unconjugated
In 1X PBS, pH 7.4
NM_018622
PRO2207|PSARL|PSARL1|PSENIP2|RHBDS1
Mouse
IgG2b Kappa
RUO
Primary
55486
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit