Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Our pricing system is unavailable. You are viewing list price.
Please call 1-800-766-7000 to place your order or try our site again later.

PSEN2, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant PSEN2.

Manufacturer:  Abnova Corporation H00005664A01

Catalog No. 89-003-062



Description

Description

Alzheimer's disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1 or PSEN2) or the amyloid precursor protein (APP). These disease-linked mutations result in increased production of the longer form of amyloid-beta (main component of amyloid deposits found in AD brains). Presenilins are postulated to regulate APP processing through their effects on gamma-secretase, an enzyme that cleaves APP. Also, it is thought that the presenilins are involved in the cleavage of the Notch receptor such that, they either directly regulate gamma-secretase activity, or themselves act are protease enzymes. Two alternatively spliced transcript variants encoding different isoforms of PSEN2 have been identified. [provided by RefSeq

Sequence: MLTFMASDSEEEVCDERTSLMSAESPTPRSCQEGRQGPEDGENTAQWRSQENEEDGEEDPDRYVCSGVPGRPPGLEEELTLKYGAK
Specifications

Specifications

PSEN2
Unconjugated
50% glycerol
NM_000447
AD3L|AD4|PS2|STM2
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant PSEN2.
PSEN2
Liquid
PSEN2
PSEN2 (NP_000438, 1 a.a. ~ 86 a.a) partial recombinant protein with GST tag.
RUO
Primary
5664
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit