Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PSG5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP157973
Description
PSG5 Polyclonal specifically detects PSG5 in Human samples. It is validated for Western Blot.Specifications
PSG5 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
Fetal liver non-specific cross-reactive antigen 3, FL-NCA-3PSG, pregnancy specific beta-1-glycoprotein 5, pregnancy-specific beta 1 glycoprotein, pregnancy-specific beta-1 glycoprotein, pregnancy-specific beta-1-glycoprotein 5, Pregnancy-specific beta-1-glycoprotein-5, Pregnancy-specific glycoprotein 5, PS-beta-G-5, PSBG-5 | |
Rabbit | |
Protein A purified | |
RUO | |
Primary | |
Expected identity based on immunogen sequence: Human: 100%. | |
Human, Mouse, Rat, Canine, Equine | |
Purified |
Western Blot | |
1 mg/ml | |
Western Blot 1.0 ug/ml | |
Q15238 | |
PSG5 | |
Synthetic peptides corresponding to PSG5(pregnancy specific beta-1-glycoprotein 5) The peptide sequence was selected from the N terminal of PSG5. Peptide sequence QLMDLYHYITSYVVDGQINIYGPAYTGRETVYSNASLLIQNVTREDAGSY. | |
100 μL | |
Immunology | |
5673 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction