Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RAB14 Rabbit anti-Human, Mouse, Rat, Porcine, Bovine, Canine, Goat, Monkey, Zebrafish, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179962

Catalog No. NBP179962


Add to cart

Description

Description

RAB14 Polyclonal antibody specifically detects RAB14 in Human, Mouse, Rat, Porcine, Bovine, Canine, Goat, Monkey, Zebrafish samples. It is validated for Western Blot, Immunohistochemistry.
Specifications

Specifications

RAB14
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
RAB14
Synthetic peptide directed towards the C terminal of human RAB14The immunogen for this antibody is RAB14. Peptide sequence FLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCG.
24 kDa
100 ul
Signal Transduction
Primary
51552
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Western Blot 1:1000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin
NP_057406
bA165P4.3 (member RAS oncogene family), F protein-binding protein 1, FBP, RAB-14, RAB14, member RAS oncogene family, ras-related protein Rab-14, small GTP binding protein RAB14
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
African clawed frog 100%.
Bovine, Canine, Goat, Human, Monkey, Mouse, Porcine, Rat, Zebrafish
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only