Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-RAP30, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP190812

Catalog No. NBP190812


Add to cart

Description

Description

RAP30 Polyclonal antibody specifically detects RAP30 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications

Specifications

RAP30
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
BTF4, General transcription factor IIF 74 kDa subunit, general transcription factor IIF subunit 1, general transcription factor IIF, polypeptide 1 (74kD subunit), general transcription factor IIF, polypeptide 1, 74kDa, RAP74Transcription initiation factor RAP74, TF2F1, TFIIF, TFIIF-alpha, Transcription initiation factor IIF subunit alpha
Rabbit
IgG
0.1 ml
Chromatin Research
Primary
2962
Human
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20-1:50
Affinity Purified
GTF2F1
This antibody was developed against Recombinant Protein corresponding to amino acids:LSNKKIYQEEEMPESGAGSEFNRKLREEARRKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTENTSYYIFTQCPDGAFEAFPVHNWYNFTPLARHRTLTAEEAEEEWERRNKVLNHFSIMQQRRLKDQDQD
Immunogen affinity purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only