Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RAS-like, family 11, member B, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human RASL11B protein.

Manufacturer:  Abnova Corporation H00065997B01

Catalog No. 89-008-138


Add to cart

Description

Description

RASL11B is a member of the small GTPase protein family with a high degree of similarity to RAS (see HRAS, MIM 190020) proteins.[supplied by OMIM

Sequence: MRLIQNMCTIAEYPAPGNAAASDCCVGAAGRRLVKIAVVGASGVGKTALVVRFLTKRFIGDYERNAGNLYTRQVQIEGETLALQVQDTPGIQVHENSLSCSEQLNRCIRWADAVVIVFSITDYKSYELISQLHQHVQQLHLGTRLPVVVVANKADLLHIKQVDPQLGLQLASMLGCSFYEVSVSENYNDVYSAFHVLCKEVSHKQQPSSTPEKRRTSLIPRPKSPNMQDLKRRFKQALSAKVRTVTSV
Specifications

Specifications

RAS-like, family 11, member B
Unconjugated
No additive
NM_023940
MGC2827|MGC4499
Mouse
50 uL
Signal Transduction
Y
Polyclonal
Human
Western Blot
Mouse polyclonal antibody raised against a full-length human RASL11B protein.
RASL11B
Serum
RASL11B
RASL11B (NP_076429, 1 a.a. ~ 248 a.a) full-length human protein.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
65997
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit