Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RCBTB2, Mouse, Clone: 4G12, Abnova™

Mouse monoclonal antibody raised against a partial recombinant RCBTB2.

Manufacturer:  Abnova Corporation H00001102M06

Catalog No. 89-021-067


  Check Availability
Add to cart

Specifications

Description

This gene encodes a member of the RCC1-related GEF family. The N-terminal half of the encoded amino acid sequence shows similarity to the regulator of chromosome condensation RCC1, which acts as a guanine nucleotide exchange factor (GEF) protein for the Ras-related GTPase Ran. [provided by RefSeq

Sequence: TIEPRRLDSLNGKKIACLSYGSGPHIVLATTEGEVFTWGHNAYSQLGNGTTNHGLVPCHISTNLSNKQVIEVACGSYHSLVLTSDGEVFAWGYNNSGQVGSGSTVNQPI
Description & Specifications

Specifications

RCBTB2
4G12
Human
Liquid
RCBTB2
CHC1L
Murine
IgG2a, κ
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
ELISA
Unlabeled
regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 2
In 1X PBS, pH 7.4
NM_001268
RCBTB2
RCBTB2 (NP_001259, 86 a.a. ∽195 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa
50μg
Human
Primary
1102
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit