Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

regulator of G-protein signaling 20, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human RGS20 protein.

Manufacturer:  Abnova Corporation H00008601B01

Catalog No. 89-006-599


Add to cart

Description

Description

Regulator of G protein signaling (RGS) proteins are regulatory and structural components of G protein-coupled receptor complexes. RGS proteins are GTPase-activating proteins for Gi (see GNAI1; MIM 139310) and Gq (see GNAQ; MIM 600998) class G-alpha proteins. They accelerate transit through the cycle of GTP binding and hydrolysis and thereby accelerate signaling kinetics and termination.[supplied by OMIM

Sequence: MRTADGGEPAGASSPAGRVDGGLQMGSERMEMRKRQMPAAQDTPGAAPGQPGAGSRGSNACCFCWCCCCSCSCLTVRNQEDQRPTIASHELRADLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVEPSQHIFDDAQLQIYTLMHRDSYPRFMNSAVYKDLLQSLSEKSIEA
Specifications

Specifications

regulator of G-protein signaling 20
Unconjugated
No additive
NM_003702
RGSZ1|ZGAP1
Mouse
50 uL
Signal Transduction
Y
Polyclonal
Human
Western Blot
Mouse polyclonal antibody raised against a full-length human RGS20 protein.
RGS20
Serum
RGS20
RGS20 (NP_003693, 1 a.a. ~ 241 a.a) full-length human protein.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
8601
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit