Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Ras-like without CAAX 2, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human RIT2 protein.

Manufacturer:  Abnova Corporation H00006014B01

Catalog No. 89-006-152


Add to cart

Description

Description

RIN belongs to the RAS (HRAS; MIM 190020) superfamily of small GTPases (Shao et al., 1999 [PubMed 10545207]).[supplied by OMIM

Sequence: MEVENEASCSPGSASGGSREYKVVMLGAGGVGKSAMTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYLDILDTAGQAEFTAMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQVRHTYEIPLVLVGNKIDLEQFRQVSTEEGLSLAQEYNCGFFETSAALRFCIDDAFHGLVREIRKKESMPSLMEKKLKRKDSLWKKLKGSLKKKRENMT
Specifications

Specifications

Ras-like without CAAX 2
Unconjugated
No additive
NM_002930
RIBA|RIN|ROC2
Mouse
50 uL
Signal Transduction
Y
Polyclonal
Human
Western Blot
Mouse polyclonal antibody raised against a full-length human RIT2 protein.
RIT2
Serum
RIT2
RIT2 (NP_002921, 1 a.a. ~ 217 a.a) full-length human protein.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
6014
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit