Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RPIP8 Rabbit anti-Human, Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP180855

Catalog No. NBP180855


Add to cart

Description

Description

RPIP8 Polyclonal antibody specifically detects RPIP8 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin).
Specifications

Specifications

RPIP8
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Affinity Purified
RUNDC3A
This antibody was developed against Recombinant Protein corresponding to amino acids:LKDLEAENRRLQLQLEEAAAQNQREKRELEGVILELQEQLTGLIPSDHAPLAQGSKELTTPLVNQWPSLGTLNGAEGASNSKL
Immunogen affinity purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of human, rat RPIP8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Q59EK9
Rap2-interacting protein 8, RAP2IPRUN domain-containing protein 3A, RPIP-8, RPIP8RaP2 interacting protein 8, RUN domain containing 3A
Rabbit
IgG
0.1 ml
Signal Transduction
Primary
10900
Human, Rat
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only