Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-RUNX3/CBFA3, Polyclonal, Novus Biologicals™

Manufacturer:  Novus Biologicals NBP180242

Catalog No. NBP180242

This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000.


Specifications

Specifications

RUNX3/CBFA3
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Purified
RUNX3
Synthetic peptide directed towards the C terminal of mouse RUNX3. Peptide sequence PYPGAPQSQSGPFQANPAPYHLFYGASSGSYQFSMAAAGGGERSPTRMLT.
45 kDa
100ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Canine: 86% .
Mouse
Western Blot
Western Blot 1:1000
NP_062706
Acute myeloid leukemia 2 protein, AML2SL3/AKV core-binding factor alpha C subunit, CBFA3MGC16070, CBF-alpha-3, PEA2 alpha C, PEA2-alpha C, PEBP2 alpha C, PEBP2A3FLJ34510, PEBP2-alpha C, runt domain, alpha subunit 3, runt-related transcription factor 3, SL3-3 enhancer factor 1 alpha C subunit, transcription factor AML2
Rabbit
IgG
Protein A purified
RUO
Primary
864
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only