S100 calcium binding protein A4, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human S100A4 protein.

Supplier:  Abnova Corporation H00006275B01

Catalog No. 89-006-182

Description

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq

Sequence: MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCDEFFEGFPDKQPRKK

Specifications

• Antigen: S100 calcium binding protein A4
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human S100A4 protein.
• Gene: S100A4
• Gene Alias: 18A2/42A/CAPL/FSP1/MTS1/P9KA/PEL98
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 6275
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: BC016300
• Gene Symbols: S100A4
• Immunogen: S100A4 (AAH16300, 1 a.a. ∼ 101 a.a) full-length human protein.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum