S100G Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP231615

Catalog No. NBP231615

Description

S100G Polyclonal specifically detects S100G in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: S100G
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: P29377
• Gene Symbols: S100G
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPSLLKGPNTLDDLFQELDK
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: CABP, CABP1, CaBP9K, CABP9KMGC138379, CALB3calbindin D9K, calbindin 3, (vitamin D-dependent calcium-binding protein), calbindin-D9K, protein S100-G, S100 calcium binding protein G, S100 calcium-binding protein G, S100D, Vitamin D-dependent calcium-binding protein, intestinal
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 795
• Target Species: Human
• Isotype: IgG

For Research Use Only