Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SAMSN1 Rabbit anti-Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP152845

Catalog No. NBP152845


Add to cart

Description

Description

SAMSN1 Polyclonal antibody specifically detects SAMSN1 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot.
Specifications

Specifications

SAMSN1
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
SAMSN1
Synthetic peptides corresponding to SAMSN1(SAM domain, SH3 domain and nuclear localization signals 1) The peptide sequence was selected from the middle region of SAMSN1 (NP_071419). Peptide sequence YVDVISEEEAAPKKIKANRRSNSKKSKTLQEFLERIHLQEYTSTLLLNGY.
42 kDa
100 ul
Stem Cell Markers
Primary
64092
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 0.2-1 ug/ml
Q9NSI8
HACS1gene with homology to KIAA0790 protein10NASH1, Hematopoietic adaptor containing SH3 and SAM domains 1, SAM and SH3 domain containing 1, SAM and SH3 domain containing 2, SAM domain, SH3 domain and nuclear localisation signals, 1, SAM domain, SH3 domain and nuclear localization signals 1, SAM domain, SH3 domain and nuclear localization signals protein 1, SAM domain-containing protein SAMSN-1, SH3D6B, SH3-SAM adaptor protein
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Guinea pig: 92%; Chicken: 85%.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only