Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SCN8A, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant SCN8A.

Manufacturer:  Abnova Corporation H00006334A01

Catalog No. 89-003-073


Add to cart

Description

Description

Voltage-dependent sodium channels, such as SCN8A, are responsible for the initial membrane depolarization that occurs during generation of action potentials in most electrically excitable cells (Plummer et al., 1998 [PubMed 9828131]).[supplied by OMIM

Sequence: RVLGDSGELDILRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYRGHLARRGFICKKTTSNKLENGGTHREKKESTPSTASLPSYDSVT
Specifications

Specifications

SCN8A
Unconjugated
50% glycerol
NM_014191
CerIII|MED|NaCh6|Nav1.6|PN4
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant SCN8A.
SCN8A
Liquid
SCN8A
SCN8A (NP_055006, 1854 a.a. ~ 1951 a.a) partial recombinant protein with GST tag.
RUO
Primary
6334
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit