Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

selectin L, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human SELL protein.

Manufacturer:  Abnova Corporation H00006402B02

Catalog No. 89-006-217


Add to cart

Description

Description

SELL is a cell surface component that is a member of a family of adhesion/homing receptors which play important roles in leukocyte-endothelial cell interactions. The molecule is composed of multiple domains: one homologous to lectins, one to epidermal growth factor, and two to the consensus repeat units found in C3/C4 binding proteins. [provided by RefSeq

Sequence: MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSKRSMNDPY
Specifications

Specifications

selectin L
Unconjugated
No additive
NM_000655
CD62L|LAM-1|LAM1|LECAM1|LNHR|LSEL|LYAM1|Leu-8|Lyam-1|PLNHR|TQ1|hLHRc
Mouse
50 uL
Cell Adhesion
Y
Polyclonal
Human
Western Blot
Mouse polyclonal antibody raised against a full-length human SELL protein.
SELL
Serum
SELL
SELL (NP_000646, 1 a.a. ~ 372 a.a) full-length human protein.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
6402
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit