Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SEPN1 Rabbit anti-Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Zebrafish, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179247

Catalog No. NBP179247


Add to cart

Description

Description

SEPN1 Polyclonal antibody specifically detects SEPN1 in Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Zebrafish samples. It is validated for Western Blot, Immunohistochemistry.
Specifications

Specifications

SEPN1
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
SEPN1
Synthetic peptide directed towards the C terminal of human SEPN1The immunogen for this antibody is SEPN1. Peptide sequence ANYFLDITSVKPEEIESNLFSFSSTFEDPSTATYMQFLKEGLRRGLPLLQ.
Immunogen affinity purified
RUO
Primary
57190
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Immunohistochemistry, Western Blot
Western Blot 1:1000, Immunohistochemistry 1:10-1:500
NP_065184
FLJ24021, rigid spine muscular dystrophy 1, RSMD1, RSS, selenoprotein N, selenoprotein N, 1, SelN, SELNMDRS1
Rabbit
IgG
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Pig: 100%; Rat: 100%; Mouse: 92%; Chicken: 78%; Zebrafish: 78%.
Bovine, Equine, Guinea Pig, Human, Mouse, Rat, Zebrafish
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only