Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

serpin peptidase inhibitor, clade B (ovalbumin), member 3 (D03P), Rabbit anti-Human, Purified MaxPab™ Polyclonal Antibody, Abnova™

Name: serpin peptidase inhibitor, clade B (ovalbumin), member 3 (D03P), Rabbit anti-Human, Purified MaxPab&trade; Polyclonal Antibody, Abnova&trade;
Brand: Abnova Corporation
SKU: 89-018-448
Price: 560.00 USD

Rabbit polyclonal antibody raised against a full-length human SERPINB3 protein.

Supplier: Abnova Corporation H00006317D03P

Catalog No. 89-018-448

$560.00 / Each of 1

Qty

Add to Cart

Description

Sequence: MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP

Specifications

Antigen	serpin peptidase inhibitor, clade B (ovalbumin), member 3
Classification	Polyclonal
Description	Rabbit polyclonal antibody raised against a full-length human SERPINB3 protein.
Gene	SERPINB3
Gene Alias	HsT1196/SCC/SCCA-1/SCCA-PD/SCCA1/T4-A
Host Species	Rabbit
Purification Method	Affinity Purified
Regulatory Status	RUO
Gene ID (Entrez)	6317
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Isotype	IgG

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS with no preservative; pH 7.4
Gene Accession No.	BC005224.1
Gene Symbols	SERPINB3
Immunogen	SERPINB3 (AAH05224, 1 a.a. ∼ 390 a.a) full-length human protein.
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Human
Product Type	Antibody

Product Suggestions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

Full Name:

Email Address:*

User Name:

Telephone Number:

What type of issue did you experience with the content on the page?*

Please provide a detailed description of the issue or request*

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Spot an opportunity for improvement?

Provide Content Correction

serpin peptidase inhibitor, clade B (ovalbumin), member 3 (D03P), Rabbit anti-Human, Purified MaxPab™ Polyclonal Antibody, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions