Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SET domain containing (lysine methyltransferase) 7, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant SET7.

Manufacturer:  Abnova Corporation H00080854A01

Catalog No. 89-004-729


Add to cart

Description

Description

Sequence: SRDWALNGNTLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFTPNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGPEAPEWYQVELKAFQATQQK
Specifications

Specifications

SET domain containing (lysine methyltransferase) 7
Unconjugated
50% glycerol
NM_030648
FLJ21193|KIAA1717|KMT7|SET7|SET7/9|SET9
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
80854
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant SET7.
SETD7
Serum
SETD7
SET7 (NP_085151, 257 a.a. ~ 366 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human, Rat
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit