SGLT2/SLC5A2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP192384

Catalog No. NBP192384

Description

SGLT2/SLC5A2 Polyclonal antibody specifically detects SGLT2/SLC5A2 in Human, Mouse, Canine samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin).

Specifications

• Antigen: SGLT2/SLC5A2
• Classification: Polyclonal
• Dilution: Western Blot reactivity reported in scientific literature (PMID: 25894829)., Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence reactivity reported in scientific literature (PMID: 25894829)., Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: Low affinity sodium-glucose cotransporter, Na(+)/glucose cotransporter 2, SGLT2sodium/glucose cotransporter 2, solute carrier family 5 (sodium/glucose cotransporter), member 2, solute carrier family 5 (sodium/glucose transporter), member 2, Solute carrier family 5 member 2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SLC5A2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:FHEVGGYSGLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLL
• Quantity: 0.1 mL
• Research Discipline: Apoptosis, Cancer, Tumor Suppressors
• Gene ID (Entrez): 6524
• Target Species: Human, Mouse, Canine
• Isotype: IgG

For Research Use Only