Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SH2 domain protein 1A, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human SH2D1A protein.

Manufacturer:  Abnova Corporation H00004068B01

Catalog No. 89-005-714


Add to cart

Description

Description

This gene encodes a protein that plays a major role in the bidirectional stimulation of T and B cells. This protein contains an SH2 domain and a short tail. It associates with the signaling lymphocyte-activation molecule, thereby acting as an inhibitor of this transmembrane protein by blocking the recruitment of the SH2-domain-containing signal-transduction molecule SHP-2 to its docking site. This protein can also bind to other related surface molecules that are expressed on activated T, B and NK cells, thereby modifying signal transduction pathways in these cells. Mutations in this gene cause lymphoproliferative syndrome X-linked type 1 or Duncan disease, a rare immunodeficiency characterized by extreme susceptibility to infection with Epstein-Barr virus, with symptoms including severe mononucleosis and malignant lymphoma. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP
Specifications

Specifications

SH2 domain protein 1A
Unconjugated
No additive
NM_002351
DSHP|EBVS|FLJ18687|FLJ92177|IMD5|LYP|MTCP1|SAP|XLP|XLPD
Mouse
50 uL
Membrane Receptors
Y
Polyclonal
Human
Western Blot
Mouse polyclonal antibody raised against a full-length human SH2D1A protein.
SH2D1A
Serum
SH2D1A
SH2D1A (NP_002342, 1 a.a. ~ 128 a.a) full-length human protein.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
4068
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit