anti-SLC25A10, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP185214

Catalog No. NBP185214

Description

SLC25A10 Polyclonal antibody specifically detects SLC25A10 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SLC25A10
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: dicarboxylate ion carrier, DICSolute carrier family 25 member 10, member 10, mitochondrial dicarboxylate carrier, solute carrier family 25 (mitochondrial carrier; dicarboxylate transporter)
• Host Species: Rabbit
• Isotype: IgG
• Quantity: 0.1 ml
• Storage Requirements: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Monoclonal or Polyclonal: Polyclonal
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Applications: Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Format: Affinity Purified
• Gene Symbols: SLC25A10
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:SLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKLPQGQRRNYAHAL
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1468
• Target Species: Human

For Research Use Only