Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLC34A3 Rabbit anti-Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179976

Catalog No. NBP179976


Add to cart

Description

Description

SLC34A3 Polyclonal antibody specifically detects SLC34A3 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig samples. It is validated for Western Blot.
Specifications

Specifications

SLC34A3
Unconjugated
PBS & 2% Sucrose. with 0.09% Sodium Azide
Affinity Purified
SLC34A3
Synthetic peptide directed towards the middle region of human SLC34A3. Peptide sequence GDRDEFQRAFSGSAVHGIFNWLTVLVLLPLESATALLERLSELALGAASL.
63 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:1000
NP_543153
Na(+)/Pi cotransporter 2C, Na(+)-dependent phosphate cotransporter 2C, naPi-2c, sodium-phosphate transport protein 2C, solute carrier family 34 (sodium phosphate), member 3
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
142680
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only