SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant SMARCC1.

Supplier:  Abnova Corporation H00006599A01

Catalog No. 89-004-315

Description

The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and contains a predicted leucine zipper motif typical of many transcription factors. [provided by RefSeq

Sequence: ESRKKSGKKGQASLYGKRRSQKEEDEQEDLTKDMEDPTPVPNIEEVVLPKNVNLKKDSENTPVKGGTVADLDEQDEETVTAGGKEDEDPAKGDQSRSVDL

Specifications

• Antigen: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant SMARCC1.
• Gene: SMARCC1
• Gene Alias: BAF155/CRACC1/Rsc8/SRG3/SWI3
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Transcription Regulation
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_003074
• Gene Symbols: SMARCC1
• Immunogen: SMARCC1 (NP_003065, 338 a.a. ∼ 437 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 6599
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.