Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant SMARCC1.

Manufacturer:  Abnova Corporation H00006599A01

Catalog No. 89-004-315


Add to cart

Description

Description

The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and contains a predicted leucine zipper motif typical of many transcription factors. [provided by RefSeq

Sequence: ESRKKSGKKGQASLYGKRRSQKEEDEQEDLTKDMEDPTPVPNIEEVVLPKNVNLKKDSENTPVKGGTVADLDEQDEETVTAGGKEDEDPAKGDQSRSVDL
Specifications

Specifications

SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1
Unconjugated
50% glycerol
NM_003074
BAF155|CRACC1|Rsc8|SRG3|SWI3
Mouse
50 uL
Transcription Regulation
Y
Polyclonal
Human
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant SMARCC1.
SMARCC1
Serum
SMARCC1
SMARCC1 (NP_003065, 338 a.a. ~ 437 a.a) partial recombinant protein with GST tag.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
6599
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit