Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

survival motor neuron domain containing 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human SMNDC1 protein.

Manufacturer:  Abnova Corporation H00010285B01

Catalog No. 89-006-945


Add to cart

Description

Description

This gene is a paralog of SMN1 gene, which encodes the survival motor neuron protein, mutations in which are cause of autosomal recessive proximal spinal muscular atrophy. The protein encoded by this gene is a nuclear protein that has been identified as a constituent of the spliceosome complex. This gene is differentially expressed, with abundant levels in skeletal muscle, and may share similar cellular function as the SMN1 gene. [provided by RefSeq

Sequence: MSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEGRKAKEDSGNKPMSKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ
Specifications

Specifications

survival motor neuron domain containing 1
Unconjugated
No additive
NM_005871
SMNR|SPF30
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
10285
Immunofluorescence, Western Blot
Mouse polyclonal antibody raised against a full-length human SMNDC1 protein.
SMNDC1
Serum
SMNDC1
SMNDC1 (NP_005862, 1 a.a. ~ 238 a.a) full-length human protein.
RUO
Y
Polyclonal
Human, Murine, Rat
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit