Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SMYD4 Rabbit anti-Human, Mouse, Rat, Canine, Equine, Guinea Pig, Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179406

Catalog No. NBP179406


Add to cart

Description

Description

SMYD4 Polyclonal antibody specifically detects SMYD4 in Human, Mouse, Rat, Canine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot.
Specifications

Specifications

SMYD4
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
SMYD4
Synthetic peptide directed towards the N terminal of human SMYD4The immunogen for this antibody is SMYD4. Peptide sequence EGNKKFQEKDYTGAAVLYSKGVSHSRPNTEDMSLCHANRSAALFHLGQYE.
Immunogen affinity purified
RUO
Primary
114826
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:1000
NP_443160
KIAA1936ZMYND21, SET and MYND domain containing 4, SET and MYND domain-containing protein 4
Rabbit
IgG
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Rabbit: 92%; Pig: 85%; Canine: 84%.
Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only