Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Snail Rabbit anti-Human, Mouse, Rat, Guinea Pig, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP180022

Catalog No. NBP180022


Add to cart

Description

Description

Snail Polyclonal antibody specifically detects Snail in Human, Mouse, Rat, Guinea Pig samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).
Specifications

Specifications

Snail
Unconjugated
PBS & 2% Sucrose. with 0.09% Sodium Azide
Affinity Purified
SNAI1
Synthetic peptide directed towards the N terminal of human SNAI1. Peptide sequence MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEIL.
29 kDa
100 ul
Breast Cancer
Primary
6615
Guinea Pig, Human, Mouse, Rat
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Western Blot 1:1000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
NP_005976
Protein sna, Protein snail homolog 1, SLUGH2, SNA, SNAHdJ710H13.1, snail 1 (drosophila homolog), zinc finger protein, snail 1 homolog, snail 1 zinc finger protein, snail 1, zinc finger protein, snail homolog 1 (Drosophila), zinc finger protein SNAI1
Rabbit
IgG
Immunogen affinity purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only