Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

synuclein, gamma (breast cancer-specific protein 1), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human SNCG protein.

Manufacturer:  Abnova Corporation H00006623B01

Catalog No. 89-006-259


Add to cart

Description

Description

Summary: This gene encodes a member of the synuclein family of proteins which are believed to be involved in the pathogenesis of neurodegenerative diseases. Mutations in this gene have also been associated with breast tumor development. [provided by RefSeq

Sequence: MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD
Specifications

Specifications

synuclein, gamma (breast cancer-specific protein 1)
Unconjugated
No additive
BC014098.2
BCSG1|SR
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
6623
Western Blot
Mouse polyclonal antibody raised against a full-length human SNCG protein.
SNCG
Serum
SNCG
SNCG (AAH14098.1, 1 a.a. ~ 127 a.a) full-length human protein.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit