Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

sorting nexin 12, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human SNX12 protein.

Manufacturer:  Abnova Corporation H00029934B01

Catalog No. 89-007-517


Add to cart

Description

Description

This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like some family members. This gene encodes a protein of unknown function. [provided by RefSeq

Sequence: MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKSLAVSCPGWSAVA
Specifications

Specifications

sorting nexin 12
Unconjugated
No additive
BC020559
MGC118982|MGC118983
Mouse
50 uL
Signal Transduction
Y
Polyclonal
Human, Murine, Rat
Western Blot
Mouse polyclonal antibody raised against a full-length human SNX12 protein.
SNX12
Serum
SNX12
SNX12 (N/A, 1 a.a. ~ 172 a.a) full-length human protein.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
29934
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit