Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Sphingosine 1 phosphate phosphatase 2 Rabbit anti-Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP153181

Catalog No. NBP153181

Add to cart



Sphingosine 1 phosphate phosphatase 2 Polyclonal antibody specifically detects Sphingosine 1 phosphate phosphatase 2 in Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).


Sphingosine 1 phosphate phosphatase 2
PBS and 2% Sucrose with 0.09% Sodium Azide
EC 3.1.3, EC 3.1.3.-, FLJ39004, hSPP2, sphingosine 1-phosphate phosphohydrolase 2, Sphingosine-1-phosphatase 2, sphingosine-1-phosphate phosphatase 2, Spp2, SPP2sphingosine-1-phosphate phosphotase 2, SPPase2
Protein A purified
Bovine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Synthetic peptides corresponding to SGPP2(sphingosine-1-phosphate phosphotase 2) The peptide sequence was selected from the C terminal of SGPP2. Peptide sequence SKPAESLPVIQNIPPLTTYMLVLGLTKFAVGIVLILLVRQLVQNLSLQVL.
37 kDa
Store at -20C. Avoid freeze-thaw cycles.
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only