sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant SPOCK3.

Supplier:  Abnova Corporation H00050859A01

Catalog No. 89-004-617

Description

Proteoglycans, which consist of a core protein and covalently linked glycosaminoglycans, are components of the extracellular matrix. SPOCK3 encodes a member of a novel Ca(2+)-binding proteoglycan family.[supplied by OMIM

Sequence: RGPILSTCKQCPVVYPSPVCGSDGHTYSFQCKLEYQACVLGKQISVKCEGHCPCPSDKPTSTSRNVKRACSDLEFREVANRLRDWFKALHESGSQNKKT

Specifications

• Antigen: sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant SPOCK3.
• Gene: SPOCK3
• Gene Alias: HSAJ1454/TES-3
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 50859
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_016950
• Gene Symbols: SPOCK3
• Immunogen: SPOCK3 (NP_058646, 132 a.a. ∼ 230 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum