small proline-rich protein 3, Mouse, Clone: 4A12, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant SPRR3.

Supplier:  Abnova Corporation H00006707M01

Catalog No. 89-014-196

Description

Sequence: MSSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTKVPVPGYTKVPEPCPSTVTPGPAQQKTKQK

Specifications

• Antigen: small proline-rich protein 3
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC017802
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6707
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG3 κ

• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Clone: 4A12
• Description: Mouse monoclonal antibody raised against a full length recombinant SPRR3.
• Gene: SPRR3
• Gene Symbols: SPRR3
• Immunogen: SPRR3 (AAH17802, 1 a.a. ∼ 161 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody