STAT3 Rabbit anti-Human, Mouse, Rat, Polyclonal, MilliporeSigma™

Rabbit Polyclonal Antibody

Supplier:  MilliporeSigma 06596

Catalog No. 06-596-MI

Description

Anti-STAT3 Antibody is a Rabbit Polyclonal Antibody for detection of STAT3 also known as Acute-phase response factor or DNA-binding protein APRF and has been validated in Chimmunoprecipitation, EMSA, immunocytochemistry, immunoprecipitation and western blotting.

Specifications

• Antigen: STAT3
• Classification: Polyclonal
• Formulation: Protein A purified rabbit IgG in 200 L of 0.1M Tris-glycine, pH 7.4, 0.15M NaCl, 0.05% sodium azide. Frozen at −20°C.
• Host Species: Rabbit
• Purification Method: Protein A purfied
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified

• Applications: Electromobility Shift Assay, Immunocytochemistry, Immunoprecipitation, Western Blot
• Conjugate: Unconjugated
• Gene Symbols: APRF; FLJ20882; HIES; MGC16063
• Immunogen: Bacterially expressed GST fusion protein corresponding to a.a. 688-722 of human STAT 3 (RPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTI). The immunizing sequence is identical in mouse and rat STAT3. The first 28 amino acids are identical to mouse STAT3B.
• Quantity: 200 μg
• Gene ID (Entrez): NM_139276
• Content And Storage: -20°C in undiluted aliquots for up to 12 months, Avoid Freeze/Thaw Cycles
• Isotype: IgG

For Research Use Only