Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

STMN2, Mouse, Clone: 1D3, Abnova™

Mouse monoclonal antibody raised against a partial recombinant STMN2.

Manufacturer:  Abnova Corporation H00011075M05

Catalog No. 89-002-785


Add to cart

Description

Description

Superior cervical ganglion-10 is a neuronal growth-associated protein that shares significant amino acid sequence similarity with the phosphoprotein stathmin (MIM 151442).[supplied by OMIM

Sequence: MAKTAMAYKEKMKELSMLSLICSCFYPEPRNINIYTYDDMEVKQINKRASGQAFELILKPPSPISEAPRTLASPKKKDLSLEEIQKKLEA
Specifications

Specifications

STMN2,
1D3
Mouse monoclonal antibody raised against a partial recombinant STMN2.
STMN2
Liquid
STMN2
STMN2 (NP_008960, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
100 ug
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
ELISA
Unconjugated
In 1X PBS, pH 7.4
NM_007029
SCG10|SCGN10|SGC10
Mouse
IgG2b Kappa
RUO
Primary
11075
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit