anti-STRAP, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP182796

Catalog No. NBP182796

Description

STRAP Polyclonal antibody specifically detects STRAP in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: STRAP
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: MAP activator with WD repeats, MAWDpt-wd, serine/threonine kinase receptor associated protein, serine-threonine kinase receptor-associated protein, UNR-interacting protein, UNRIPPT-WD, WD-40 repeat protein PT-WD
• Host Species: Rabbit
• Isotype: IgG
• Quantity: 0.1 ml
• Storage Requirements: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Monoclonal or Polyclonal: Polyclonal
• Test Specificity: Specificity of human STRAP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Format: Affinity Purified
• Gene Symbols: STRAP
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:AFSGITPYGYFLISACKDGKPMLRQGDTGDWIGTFLGHKGAVWGATLNKDATKAATAAADFTAKVWDAVSGDELMTL
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 11171
• Target Species: Human, Mouse, Rat

For Research Use Only