spectrin repeat containing, nuclear envelope 1, Mouse, Clone: 4C3, Abnova™

Mouse monoclonal antibody raised against a partial recombinant SYNE1.

Supplier:  Abnova Corporation H00023345M01

Catalog No. 89-014-285

Description

This gene encodes a spectrin repeat containing protein expressed in skeletal and smooth muscle, and peripheral blood lymphocytes, that localizes to the nuclear membrane. Mutations in this gene have been associated with autosomal recessive spinocerebellar ataxia 8, also referred to as autosomal recessive cerebellar ataxia type 1 or recessive ataxia of Beauce. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq

Sequence: LRKIQQSVSEFEDKLAVPIKICSSATETYKVLQEHMDLCQALESLSSAITAFSASARKVVNRDSCVQEAAALQQQYEDILRRAKERQTALENLLAHWQRLEKELSSFLTW

Specifications

• Antigen: spectrin repeat containing, nuclear envelope 1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_182961
• Gene Symbols: SYNE1
• Immunogen: SYNE1 (NP_892006, 1561 a.a. ∼ 1670 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 50 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 4C3
• Description: Mouse monoclonal antibody raised against a partial recombinant SYNE1.
• Gene: SYNE1
• Gene Alias: 8B/CPG2/DKFZp781J13156/FLJ30878/FLJ41140/KIAA0796/KIAA1262/KIAA1756/MYNE1/SCAR8
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 23345
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG3 κ