Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TEA domain family member 4, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human TEAD4 protein.

Manufacturer:  Abnova Corporation H00007004B01

Catalog No. 89-006-342


Add to cart

Description

Description

This gene product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is preferentially expressed in the skeletal muscle, and binds to the M-CAT regulatory element found in promoters of muscle-specific genes to direct their gene expression. Alternatively spliced transcripts encoding distinct isoforms, some of which are translated through the use of a non-AUG (UUG) initiation codon, have been described for this gene. [provided by RefSeq

Sequence: MAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
Specifications

Specifications

TEA domain family member 4
Unconjugated
No additive
NM_201443.1
EFTR-2|MGC9014|RTEF1|TCF13L1|TEF-3|TEFR-1|hRTEF-1B
Mouse
50 uL
Stem Cell Biology
Y
Polyclonal
Human
Immunofluorescence, Western Blot
Mouse polyclonal antibody raised against a full-length human TEAD4 protein.
TEAD4
Serum
TEAD4
TEAD4 (NP_958851.1, 1 a.a. ~ 305 a.a) full-length human protein.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
7004
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit