transcription factor A, mitochondrial, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human TFAM protein.

Supplier:  Abnova Corporation H00007019B01P

Catalog No. 89-006-345

Description

This gene encodes a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this gene product is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns-Sayre syndrome was produced when expression of this gene was eliminated by targeted disruption in heart and muscle cells. [provided by RefSeq

Sequence: MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC

Specifications

• Antigen: transcription factor A, mitochondrial
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human TFAM protein.
• Gene: TFAM
• Gene Alias: MtTF1/TCF6/TCF6L1/TCF6L2/TCF6L3/mtTFA
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 7019
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_003201.1
• Gene Symbols: TFAM
• Immunogen: TFAM (NP_003192.1, 1 a.a. ∼ 246 a.a) full-length human protein.
• Quantity: 50 μg
• Research Discipline: Cell Cycle
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody