Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

transcription factor A, mitochondrial, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human TFAM protein.

Manufacturer:  Abnova Corporation H00007019B01P

Catalog No. 89-006-345


Add to cart

Description

Description

This gene encodes a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this gene product is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns-Sayre syndrome was produced when expression of this gene was eliminated by targeted disruption in heart and muscle cells. [provided by RefSeq

Sequence: MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC
Specifications

Specifications

transcription factor A, mitochondrial
Unconjugated
In 1X PBS, pH 7.4
NM_003201.1
MtTF1|TCF6|TCF6L1|TCF6L2|TCF6L3|mtTFA
Mouse
Protein A column
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
7019
Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
Mouse polyclonal antibody raised against a full-length human TFAM protein.
TFAM
Affinity Purified
TFAM
TFAM (NP_003192.1, 1 a.a. ~ 246 a.a) full-length human protein.
50 ug
Cell Cycle
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit