Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Thioredoxin-2 Rabbit anti-Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Zebrafish, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP154672

Catalog No. NBP154672


Add to cart

Description

Description

Thioredoxin-2 Polyclonal antibody specifically detects Thioredoxin-2 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Zebrafish samples. It is validated for Western Blot.
Specifications

Specifications

Thioredoxin-2
LYOPH
Western Blot 0.2-1 ug/ml
Q99757
mitochondrial thioredoxin, MTRX, MT-TRX, thioredoxin 2, thioredoxin, mitochondrial, thioredoxin-2, TRX2
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.
Western Blot
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
TXN2
Synthetic peptides corresponding to TXN2(thioredoxin 2) The peptide sequence was selected from the middle region of TXN2 (NP_036605). Peptide sequence QHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQ.
12 kDa
50ul
Breast Cancer
Primary
25828
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat, Zebrafish
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only