Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-Thyroid receptor-interacting protein 12, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP234035

Catalog No. NBP234035


Add to cart

Description

Description

Thyroid receptor-interacting protein 12 Polyclonal antibody specifically detects Thyroid receptor-interacting protein 12 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications

Specifications

Thyroid receptor-interacting protein 12
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Affinity Purified
TRIP12
This antibody was developed against a recombinant protein corresponding to amino acids: AMCKEIIPTSEFINSKLTAKANRQLQDPLVIMTGNIPTWLTELGKTCPFFFPFDTRQMLFYVTAFDRDRAMQRLLDTNPEINQSDSQD
Immunogen affinity purified
RUO
Primary
9320
Human
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Q14669
EC 6.3.2.-, KIAA0045ULF, MGC138849, MGC138850, probable E3 ubiquitin-protein ligase TRIP12, thyroid hormone receptor interactor 12, thyroid receptor interacting protein 12, Thyroid receptor-interacting protein 12, TR-interacting protein 12, TRIP-12
Rabbit
IgG
0.1 ml
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only