Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

translocase of inner mitochondrial membrane 8 homolog A (yeast), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human TIMM8A protein.

Manufacturer:  Abnova Corporation H00001678B01

Catalog No. 89-005-240


Add to cart

Description

Description

This translocase is involved in the import and insertion of hydrophobic membrane proteins from the cytoplasm into the mitochondrial inner membrane. The gene is mutated in Mohr-Tranebjaerg syndrome/Deafness Dystonia Syndrome (MTS/DDS) and it is postulated that MTS/DDS is a mitochondrial disease caused by a defective mitochondrial protein import system. Defects in this gene also cause Jensen syndrome; an X-linked disease with opticoacoustic nerve atrophy and muscle weakness. This protein, along with TIMM13, forms a 70kDa heterohexamer. Alternative splicing results in multiple transcript variants encoding distinct isoforms

Sequence: MDSSSSSSAAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD
Specifications

Specifications

translocase of inner mitochondrial membrane 8 homolog A (yeast)
Unconjugated
No additive
NM_004085
DDP|DDP1|DFN1|MGC12262|MTS
Mouse
50 uL
Neurobiology
Y
Polyclonal
Human
Immunofluorescence, Western Blot
Mouse polyclonal antibody raised against a full-length human TIMM8A protein.
TIMM8A
Serum
TIMM8A
TIMM8A (NP_004076, 1 a.a. ~ 97 a.a) full-length human protein.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
1678
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit