Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TIMP metallopeptidase inhibitor 4, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human TIMP4 protein.

Manufacturer:  Abnova Corporation H00007079B01

Catalog No. 89-006-360


Add to cart

Description

Description

This gene belongs to the TIMP gene family. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. The secreted, netrin domain-containing protein encoded by this gene is involved in regulation of platelet aggregation and recruitment and may play role in hormonal regulation and endometrial tissue remodeling. [provided by RefSeq

Sequence: MPGSPRPAPSWVLLLRLLALLRPPGLGEACSCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEGLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLGRKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQP
Specifications

Specifications

TIMP metallopeptidase inhibitor 4
Unconjugated
No additive
BC010553
TIMP4
TIMP4 (AAH10553, 1 a.a. ~ 224 a.a) full-length human protein.
RUO
Y
Polyclonal
Human
Western Blot
Mouse polyclonal antibody raised against a full-length human TIMP4 protein.
TIMP4
Serum
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
7079
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit