Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TKTL1 Rabbit anti-Human, Mouse, Rat, Canine, Equine, Guinea Pig, Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP154864

Catalog No. NBP154864


Add to cart

Description

Description

TKTL1 Polyclonal antibody specifically detects TKTL1 in Human, Mouse, Rat, Canine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).
Specifications

Specifications

TKTL1
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
TKTL1
Synthetic peptides corresponding to TKTL1(transketolase-like 1) The peptide sequence was selected from the middle region of TKTL1. Peptide sequence QIQTSRNLDPQPPIEDSPEVNITDVRMTSPPDYRVGDKIATRKACGLALA.
65 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Mouse: 85%; Porcine: 79%; Rat: 77%; .
Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
P51854
TK 2, TKR, TKR EC 2.2.1.1, TKT2Transketolase 2, transketolase-2, transketolase-like 1, transketolase-like protein 1, Transketolase-related protein
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
8277
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only