Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TMPRSS2, Mouse, Clone: 2F4, Abnova™

Mouse monoclonal antibody raised against a partial recombinant TMPRSS2.

Manufacturer:  Abnova Corporation H00007113M05

Catalog No. 89-002-707


Add to cart

Description

Description

This gene encodes a protein that belongs to the serine protease family. The encoded protein contains a type II transmembrane domain, a receptor class A domain, a scavenger receptor cysteine-rich domain and a protease domain. Serine proteases are known to be involved in many physiological and pathological processes. This gene was demonstrated to be up-regulated by androgenic hormones in prostate cancer cells and down-regulated in androgen-independent prostate cancer tissue. The protease domain of this protein is thought to be cleaved and secreted into cell media after autocleavage. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: GWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG
Specifications

Specifications

TMPRSS2
2F4
Mouse monoclonal antibody raised against a partial recombinant TMPRSS2.
TMPRSS2
Liquid
TMPRSS2
TMPRSS2 (NP_005647, 383 a.a. ~ 492 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
100 ug
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
ELISA, Western Blot
Unconjugated
In 1X PBS, pH 7.4
NM_005656
FLJ41954|PP9284|PRSS10
Mouse
IgG2a Kappa
RUO
Primary
7113
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit