Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-TNFAIP8L1, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP191434

Catalog No. NBP191434


Add to cart

Description

Description

TNFAIP8L1 Polyclonal antibody specifically detects TNFAIP8L1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

TNFAIP8L1
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
TNFAIP8L1
Synthetic peptide directed towards the middle region of human TNFAIP8L1. Peptide sequence AKSHGRINHVFGHLADCDFLAALYGPAEPYRSHLRRICEGLGRMLDEGSL.
Immunogen affinity purified
RUO
Primary
126282
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:1000
NP_689575
FLJ39932, MGC17791, TNF alpha-induced protein 8-like protein 1, TNFAIP8-like protein 1, tumor necrosis factor alpha-induced protein 8-like protein 1, tumor necrosis factor, alpha-induced protein 8-like 1, tumor necrosis factor, alpha-induced protein 8-like protein 1
Rabbit
IgG
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Canine: 100%; Chicken: 85%.
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only