Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TPSD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP231981
Description
TPSD1 Polyclonal specifically detects TPSD1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
TPSD1 | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
Q9BZJ3 | |
TPSD1 | |
This antibody was developed against a recombinant protein corresponding to amino acids: NVHLPPPYPLKEVEVPVVENHLCNAEYHTGLHTGHSFQIVRD | |
0.1 mL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
Delta-tryptase, EC 3.4.21, EC 3.4.21.59, HmMCP-3-like tryptase III, Mast cell mMCP-7-like, mast cell tryptase, MCP7L1, MCP7-LIKE, MGC95428, MMCP-7L, mMCP-7-like delta II tryptase, mMCP-7-like-1, mMCP-7-like-2, tryptase delta, tryptase delta 1, Tryptase-3 | |
Rabbit | |
Affinity Purified | |
RUO | |
23430 | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?
Provide Content Correction