Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TPX2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Supplier: Novus Biologicals NBP188312
Description
TPX2 Polyclonal specifically detects TPX2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
TPX2 | |
Polyclonal | |
Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
C20orf1HCTP4, C20orf2, chromosome 20 open reading frame 1, Differentially expressed in cancerous and non-cancerous lung cells 2, differentially expressed in lung cells, DIL2, DIL-2FLS353, HCA519, Hepatocellular carcinoma-associated antigen 519, P100, p100GD:C20orf1, preferentially expressed in colorectal cancer, Protein fls353, REPP86, restricted expression proliferation associated protein 100, Restricted expression proliferation-associated protein 100, targeting protein for Xklp2, TPX2, microtubule-associated protein homolog, TPX2, microtubule-associated, homolog (Xenopus laevis) | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
TPX2 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:QELEKSMKMQQEVVEMRKKNEEFKKLALAGIGQPVKKSVSQVTKSVDFHFRTDERIKQHPKNQEEYKEVNFTSELRKHPSSPARVTKGCTIVKPFNLSQGKKRTFDETVSTYVPLAQQVEDFHKRTPNRYHLRSKKD | |
0.1 mL | |
Cancer, Cell Biology, Cell Cycle and Replication, Chromatin Research, DNA Repair, Mitotic Regulators | |
22974 | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?
Provide Content Correction