Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-TR2IT1, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP231707

Catalog No. NBP231707


Add to cart

Description

Description

TR2IT1 Polyclonal antibody specifically detects TR2IT1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

TR2IT1
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Affinity Purified
TXNRD3NB
This antibody was developed against a recombinant protein corresponding to amino acids: SSLEHGDKVFGQGFPSPLEEIKRLLKISRALQARSVPSTQEKAKCLSGEPGQPEGKGQETYPGPGKVEGKAEPAMRKDDVCP
Immunogen affinity purified
RUO
Primary
645840
Human
Immunohistochemistry, Immunohistochemistry (Paraffin)
Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Q6F5E7
Protein TXNRD3NB, Thioredoxin Reductase 2 Intronic Transcript 1, Thioredoxin Reductase 3 Intronic Transcript 1, thioredoxin reductase 3 neighbor, Thioredoxin Reductase 3 Neighbor Gene Protein, Thioredoxin Reductase 3 New Transcript 1, TXNRD3 Neighbor Gene Protein, TXNRD3IT1, TXNRD3NB, TXNRD3NT1
Rabbit
IgG
0.1 ml
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only